Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319560.1	internal	137	413-3(-)
Amino Acid sequence :
LDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILVLIKENFDF RPGMMSINLDLLRGGNF
Physicochemical properties
Number of amino acids:		137
Molecular weight:		12,740.944
Theoretical pI:		9.669
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22000 22125
Instability index:		49.309
aromaticity		0.080
GRAVY		0.354
Secondary Structure Fraction
Helix		0.366
turn		0.188
sheet		0.339

Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319560.1	5prime_partial	112	412-74(-)
Amino Acid sequence :
SMRTPSFTSTHQVASSLVAHMEMPVSLAGKSSSIPMEAGELMVVVLSQERTQLRWTGAVLTLLGRQQRVWLPQDLLAAVLCRFLMLLVWLNHFLCLLTLTRQEQSPTRIFWF*
Physicochemical properties
Number of amino acids:		112
Molecular weight:		12,740.944
Theoretical pI:		9.669
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22000 22125
Instability index:		49.309
aromaticity		0.080
GRAVY		0.354
Secondary Structure Fraction
Helix		0.366
turn		0.188
sheet		0.339