Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319560.1 | internal | 137 | 413-3(-) |
Amino Acid sequence : | |||
LDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILVLIKENFDF RPGMMSINLDLLRGGNF | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 12,740.944 | ||
Theoretical pI: | 9.669 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 49.309 | ||
aromaticity | 0.080 | ||
GRAVY | 0.354 | ||
Secondary Structure Fraction | |||
Helix | 0.366 | ||
turn | 0.188 | ||
sheet | 0.339 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319560.1 | 5prime_partial | 112 | 412-74(-) |
Amino Acid sequence : | |||
SMRTPSFTSTHQVASSLVAHMEMPVSLAGKSSSIPMEAGELMVVVLSQERTQLRWTGAVLTLLGRQQRVWLPQDLLAAVLCRFLMLLVWLNHFLCLLTLTRQEQSPTRIFWF* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,740.944 | ||
Theoretical pI: | 9.669 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 49.309 | ||
aromaticity | 0.080 | ||
GRAVY | 0.354 | ||
Secondary Structure Fraction | |||
Helix | 0.366 | ||
turn | 0.188 | ||
sheet | 0.339 |