Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319569.1 | internal | 165 | 2-496(+) |
Amino Acid sequence : | |||
EVTIDLSPLLRVFKDGHVERMFGSPIVPPSLEDPTTGVASKDIDISPDIRARVYLPKLTNTTNEKLPILVYYHGGGFCLESAFSFLDHRYLNLIVSEAKVIAISVEYRLAPEHPLPIAYE DSWTALQWVVSHVLENPGFEKEPWLVNHGNFEKVLIGGDSAGGNI | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,339.674 | ||
Theoretical pI: | 5.028 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 32.423 | ||
aromaticity | 0.097 | ||
GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
Helix | 0.370 | ||
turn | 0.267 | ||
sheet | 0.248 |