Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319570.1 | internal | 145 | 437-3(-) |
Amino Acid sequence : | |||
GLKGKLIASVEVKCGGHSIHDIFHMNTHHITKISPNKVQHFEVHEGETIKVGSIVGWKYSDDGKDKTCKQVIEAVDLEKKSITWKVIGGDLLELYNSFTIITSCDDHWTTWTLLYEKKTE DTPEPLVFLGYALHVTKEVEDHLVK | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 16,441.596 | ||
Theoretical pI: | 6.043 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 18.367 | ||
aromaticity | 0.083 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.172 | ||
sheet | 0.193 |