Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319578.1 | 3prime_partial | 140 | 15-434(+) |
Amino Acid sequence : | |||
MDSGDNEVTIDLSPLLRVFKDGHVERMFGSPIVPPSLEDPTTGVASKDIDISPDIRARVYLPKLTNTTNEKLPILVYYHGGGFCLESAFSFLDHRYLNLIVSEAKVIAISVEYRLAPEHP LPIAYEDSWTALQWVVSHVL | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,651.695 | ||
Theoretical pI: | 4.934 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 33.314 | ||
aromaticity | 0.093 | ||
GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
Helix | 0.371 | ||
turn | 0.243 | ||
sheet | 0.250 |