Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319584.1	internal	118	354-1(-)
Amino Acid sequence :
DPKKMAIMSIWMEVESQKFDPIASKLTFEIVIKPMLGMVTDDAAVAENEEKLGKVLDVYESRLKDSKYLGGDSFTLADLHHAPALNYLMGTKVKNLFDARPHVSAWCADILARPAWSK
Physicochemical properties
Number of amino acids:		118
Molecular weight:		13,211.210
Theoretical pI:		5.898
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 20970
Instability index:		36.185
aromaticity		0.085
GRAVY		-0.136
Secondary Structure Fraction
Helix		0.305
turn		0.186
sheet		0.322