Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319590.1	internal	144	3-434(+)
Amino Acid sequence :
TGRRDGRISNASEALANIPPPTSNFSSLQTSFASKGLDLKDLVLLSGAHTIGVSHCPSFSSRLYNFTGVWGKQDPSLDGEYAANLKMKKCKSINDNTTIVEMDPGSTSKFDLGYYKLVLK RRGLFQSDAALTTSATTKSYINHL
Physicochemical properties
Number of amino acids:		144
Molecular weight:		15,624.448
Theoretical pI:		9.300
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		36.847
aromaticity		0.083
GRAVY		-0.365
Secondary Structure Fraction
Helix		0.271
turn		0.306
sheet		0.215