Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319592.1 | internal | 164 | 493-2(-) |
Amino Acid sequence : | |||
LFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFV KAAQPGYYDAIIVDSSDPIGPAKDSFERPFFEAVAKTLRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 17,783.089 | ||
Theoretical pI: | 4.639 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 11920 | ||
Instability index: | 32.380 | ||
aromaticity | 0.116 | ||
GRAVY | 0.157 | ||
Secondary Structure Fraction | |||
Helix | 0.372 | ||
turn | 0.238 | ||
sheet | 0.201 |