Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319594.1 | internal | 158 | 1-474(+) |
Amino Acid sequence : | |||
AGILLNDIPGRFQGEKSSPPNENSVRGYEVIDEAKQRIKTMCPAASVSCADILALAARDSVAMLGGIPYPVRLGRRDARTANFTGALTQLPAPFDDLNVQLTKFRAKGMSAREMVALAGA HTVGFARCVTMCDDRNINPARKSTLNCGCPVNNNNTNL | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 16,833.164 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 48.999 | ||
aromaticity | 0.096 | ||
GRAVY | 0.291 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.299 | ||
sheet | 0.268 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319594.1 | internal | 157 | 473-3(-) |
Amino Acid sequence : | |||
KFVLLLLTGQPQFNVDFLAGLMFLSSHIVTQRANPTVWAPANATISRADIPFALNFVNWTLRSSNGAGSCVNAPVKLAVLASLRPSLTGYGIPPNIATESRAARARISAQETDAAGHIVL ILCLASSITSYPLTEFSFGGDDFSPWNLPGISFRRMP | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 16,833.164 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 48.999 | ||
aromaticity | 0.096 | ||
GRAVY | 0.291 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.299 | ||
sheet | 0.268 |