Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319602.1 | internal | 170 | 510-1(-) |
Amino Acid sequence : | |||
PADQGVEGSIWQLAKAYVTVIDSGIHQLICHWLNTHAVIEPFVITANRQLSVLHPIHKLLQPHFRDTMNINALARQMLVNCGGFVETLVFPAKYSMEMSAVVYKDWVFPEQALPADLIKR GVAVEDSSSPHGIRLLIQDYPYAADGMKIWSAIKSWVTEYCNFYYKSDDA | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 19,207.893 | ||
Theoretical pI: | 5.941 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39545 | ||
Instability index: | 46.209 | ||
aromaticity | 0.112 | ||
GRAVY | 0.042 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.200 | ||
sheet | 0.247 |