Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319604.1 | internal | 132 | 398-3(-) |
Amino Acid sequence : | |||
YREWGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFF EAVAKALRPGGV | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,455.464 | ||
Theoretical pI: | 4.773 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 32.755 | ||
aromaticity | 0.129 | ||
GRAVY | 0.225 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.235 | ||
sheet | 0.205 |