Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319607.1 | internal | 128 | 2-385(+) |
Amino Acid sequence : | |||
SRTLEAKYIDYFTELGNWKVVPVGSPVQEPITNDEDEVELISWLGKKDENSTVFVSFGSEYFLSKEDREEIAFGLEPSNVNFIWVARFPKGEEQNLEDALPKGFLERVGDRGRVLDKFAP QPRILDHP | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,675.202 | ||
Theoretical pI: | 4.573 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 38.638 | ||
aromaticity | 0.117 | ||
GRAVY | -0.543 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.250 | ||
sheet | 0.250 |