Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319608.1	internal	114	343-2(-)
Amino Acid sequence :
FSFIDAVKRLVEAECPGVVSCADIIALVARDAVVTTGGPFWNVPTGRRDGTISNVSEANADIPAPTSNFTRLQQSFAKKGLDLKDLVLLSGAHTIGVSHCSSFTERLYNFTGVL
Physicochemical properties
Number of amino acids:		114
Molecular weight:		12,141.661
Theoretical pI:		6.082
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		36.599
aromaticity		0.079
GRAVY		0.195
Secondary Structure Fraction
Helix		0.325
turn		0.254
sheet		0.219