Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319613.1 | 5prime_partial | 120 | 379-17(-) |
Amino Acid sequence : | |||
YNQNGDNLPDATLEKTYYSGLKSICPTSGGDNNISPLDVASPVRFDNSYFKLLLWGKGLLNSDEVLLTGNVKKTKELVKSYAENEALFLHQFAKSMVKMGKINPLTELKGEIRKNCRRVN * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,427.214 | ||
Theoretical pI: | 9.080 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 29.291 | ||
aromaticity | 0.083 | ||
GRAVY | -0.497 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.292 | ||
sheet | 0.250 |