Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319618.1	internal	145	437-3(-)
Amino Acid sequence :
RAKTLAEIATCCEEWGFFQLVNHGIPVELLEKVKRVSSESFKKEREEKFNKSTALKLLTEIEKNKGSNGKVENIDWEDVFLLTDDNEWPSHIPQFRETMEEYRSELETLAERVMEVMDEN LGLPKGYIKKSFNNGAENGSDKAFF
Physicochemical properties
Number of amino acids:		145
Molecular weight:		16,795.719
Theoretical pI:		4.955
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19480 19605
Instability index:		33.293
aromaticity		0.097
GRAVY		-0.717
Secondary Structure Fraction
Helix		0.283
turn		0.214
sheet		0.317