Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319619.1	internal	117	352-2(-)
Amino Acid sequence :
ELRPDFHVAAQNCWVKKGGAYTGEVSAEMLVNLNIPWVILGHSERRAILGESNEFVGDKVAYAISQGLKVIACVGETLEQRESGSTMEVVAAQTKAIAEKVTDWSKVVIAYEPVWAI
Physicochemical properties
Number of amino acids:		117
Molecular weight:		12,774.472
Theoretical pI:		5.146
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26470 26595
Instability index:		27.867
aromaticity		0.077
GRAVY		0.068
Secondary Structure Fraction
Helix		0.333
turn		0.197
sheet		0.299