Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319620.1 | internal | 158 | 476-3(-) |
Amino Acid sequence : | |||
NHSHATKDLYDSIAAGNYPEWKLFIQIMDTEDVDKFDFDPLDVTKIWPEDIFPLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDTLLQTRIFAYADTQRHRIGPNYMQLPVN APKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAE | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 18,435.422 | ||
Theoretical pI: | 5.021 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 47.744 | ||
aromaticity | 0.120 | ||
GRAVY | -0.605 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.222 | ||
sheet | 0.228 |