Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319626.1 | 5prime_partial | 122 | 385-17(-) |
Amino Acid sequence : | |||
KLYNQNGDNLPDATLEKTYYSGLKSICPTSGGDNNISPLDVASPVRFDNSYFKLLLWGKGLLNSDEVLLTGNVKKTKELVKSYAENEALFLHQFAKSMVKMGKINPLTELKGEIRKNCRR VN* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,668.543 | ||
Theoretical pI: | 9.229 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 28.279 | ||
aromaticity | 0.082 | ||
GRAVY | -0.489 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.287 | ||
sheet | 0.254 |