Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319627.1	internal	123	369-1(-)
Amino Acid sequence :
DQHAYIQQLREGVPNFFATFIEVLRDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESITVTVEEVTPRSVGALVALYERAVGIYASLVNINAYHQPGVEAGKKATGEVLALQKR VLQ
Physicochemical properties
Number of amino acids:		123
Molecular weight:		13,619.219
Theoretical pI:		5.299
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 14440
Instability index:		44.295
aromaticity		0.089
GRAVY		-0.177
Secondary Structure Fraction
Helix		0.333
turn		0.211
sheet		0.276