Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319627.1 | internal | 123 | 369-1(-) |
Amino Acid sequence : | |||
DQHAYIQQLREGVPNFFATFIEVLRDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESITVTVEEVTPRSVGALVALYERAVGIYASLVNINAYHQPGVEAGKKATGEVLALQKR VLQ | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,619.219 | ||
Theoretical pI: | 5.299 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 44.295 | ||
aromaticity | 0.089 | ||
GRAVY | -0.177 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.211 | ||
sheet | 0.276 |