Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319642.1 | internal | 194 | 582-1(-) |
Amino Acid sequence : | |||
AFVTLRADGEREFMFYRNPSADMLLTPDELNLDLIRSAKVFHYGSISLIVEPCRAAHLKAMEAAKEAGALLSYDPNLRLPLWPSAEEARTQIKSIWDKADVIKVSDVELEFLTGSDKIDD ESAMSLWHPNLKLLLVTLGEKGCNYYTKKFHGSVEAFHVKTVDTTGAGDSFVGALLTKIVDDQAILGDEARLKE | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 21,544.348 | ||
Theoretical pI: | 5.077 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 16.384 | ||
aromaticity | 0.082 | ||
GRAVY | -0.128 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.186 | ||
sheet | 0.330 |