Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319650.1 | internal | 147 | 442-2(-) |
Amino Acid sequence : | |||
RHIYSHSSISMSTHFLGSPFPFTIQFSSHNKKLSSLTMAACIHSSRTTKTPPKNNSQIDNNVYNYVKYCRPNFPNLISYNPISEKTTKIDEEGGDRLWLKMKDEARADIDQEPILSNYYI SSILAHESMENALANHLSMKLSNSNLP | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 16,724.658 | ||
Theoretical pI: | 8.547 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 55.744 | ||
aromaticity | 0.088 | ||
GRAVY | -0.603 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.327 | ||
sheet | 0.211 |