Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319652.1 | internal | 204 | 1-612(+) |
Amino Acid sequence : | |||
YVCNPATQDWKVLPLPQYYHGDEAAAVLAFEPSLRNIEAYYHVICAIPMLGQPIIGFEIYSSESNSWSCSSAYCTDLVNPELHGGGSYMKGVAYYETKSKEVVAFDVKNEIPAIISLPIL QAGRHGSLTQMEGELCYVTAKNECGNVFLIDIYQGMEMSLERSVSINLGPETNFTQACEVLPCVNSDAVAIHVDNFIYFYHIRE | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 22,697.521 | ||
Theoretical pI: | 4.671 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 32360 | ||
Instability index: | 50.646 | ||
aromaticity | 0.113 | ||
GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.250 | ||
sheet | 0.260 |