Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319653.1 | internal | 134 | 402-1(-) |
Amino Acid sequence : | |||
GIDRCAYVGHSVSAIIGILASIRRPELFSKLILIGASPRFLNDEDYHGGFEQGEIEKVFSAMEANYAAWVNGFAPLAVGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRGVLGLV KVPCHIFQTARDHS | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,729.728 | ||
Theoretical pI: | 6.460 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 36.409 | ||
aromaticity | 0.104 | ||
GRAVY | 0.184 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.239 | ||
sheet | 0.254 |