Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319657.1 | internal | 129 | 388-2(-) |
Amino Acid sequence : | |||
NPRVSSSRRKSRKAHFTAPSSLRRVLMSAPLNSELRAKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRKKWVIHIERITREKVNGSTVNVGIHPPKVVVTKLRLDKDRKSLIDRKAK GRVNADKDK | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,854.141 | ||
Theoretical pI: | 11.295 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 39.570 | ||
aromaticity | 0.039 | ||
GRAVY | -0.883 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.225 | ||
sheet | 0.155 |