Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319661.1	internal	123	369-1(-)
Amino Acid sequence :
VLSGIYFENILEPICNTVSTKARHLSPQRRYLNQKLGQLKNPTLLPGVKCRDEWHLLSEIWVNDETVQEALHVRKGTHGVWKQCPNYEKMPFTRTINNTIPFHASLSKKGYRSLIYSGDN DMY
Physicochemical properties
Number of amino acids:		123
Molecular weight:		14,288.208
Theoretical pI:		9.220
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		25440 25565
Instability index:		41.015
aromaticity		0.098
GRAVY		-0.579
Secondary Structure Fraction
Helix		0.317
turn		0.252
sheet		0.203