Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319662.1 | 5prime_partial | 201 | 657-52(-) |
Amino Acid sequence : | |||
TRNIAQLTKVKIMKKQGEWQDLQIPPSVRSIVCLNLPSFSGGLNPRGTPNSNKRRYRDLTPPFVDDGLLEVVGFRDAWHGLVLLAPKGHGTRLAQAHGIRFEFHKGAADHTFMRIDGEPW KQPLPENDSTVVVEISHLGQVKMLATHDCRAKSIHDPSSQFNHEADEVDSDEENLVDEERRKFGAADTFKIPDEVDVSSLS* | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 22,512.044 | ||
Theoretical pI: | 5.972 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 37.118 | ||
aromaticity | 0.065 | ||
GRAVY | -0.584 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.244 | ||
sheet | 0.224 |