Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319668.1 | internal | 101 | 305-3(-) |
Amino Acid sequence : | |||
KDPGEYWRAVMKDEPMPEAIQHFMPPRHSSVPLSKEKTDFHKSTFEPRPNVSVYHDYTQLEGAKKSLFSKDFEPRPNVSSYHDDDAGIKQEKDFEPRPNVS | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,761.911 | ||
Theoretical pI: | 5.937 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 39.836 | ||
aromaticity | 0.109 | ||
GRAVY | -1.216 | ||
Secondary Structure Fraction | |||
Helix | 0.218 | ||
turn | 0.277 | ||
sheet | 0.188 |