Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319675.1 | internal | 164 | 492-1(-) |
Amino Acid sequence : | |||
SELLLRIKPMDDANARCPMGPKYGALPEEVEPLLQAAHAARLTVSGVSFHIGSGDADSNAYLGAIAAAKEVFQTAAKFGMSKMTILDIGGGFTSGHQFTTAATAVKSALSQHFHDETELT IIAEPGRFFAETAFTLATTIIGKRVRGELREYWINDGLYGSMNC | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 17,540.739 | ||
Theoretical pI: | 5.693 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 29.982 | ||
aromaticity | 0.085 | ||
GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.220 | ||
sheet | 0.323 |