Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319681.1 | 5prime_partial | 124 | 518-144(-) |
Amino Acid sequence : | |||
GGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR GERA* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,907.125 | ||
Theoretical pI: | 10.985 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 43.981 | ||
aromaticity | 0.056 | ||
GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.145 | ||
sheet | 0.306 |