Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319684.1 | internal | 129 | 2-388(+) |
Amino Acid sequence : | |||
LGHVCYHILAAGLNGYMATLTNLKNPVNKWRCGAAPITAMMSVKRYGRGPGKLSVGKPAVHPATVDLKGKSYELLSQNATKFLLDDVYRNPGPLQFDGAGADAKAVTLCVEDQDYMGRIK KLQEYLDRF | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,115.207 | ||
Theoretical pI: | 9.302 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 28.367 | ||
aromaticity | 0.085 | ||
GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.233 | ||
sheet | 0.271 |