Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319707.1 | internal | 113 | 341-3(-) |
Amino Acid sequence : | |||
RKEANILHEKISNKAYNDEELIRIISTRGKAQLNATFNHYTDHHGHEIIKDLETDSDDEFLKLLGAAIECLKTPEKYFEKVLRLAIRKLGTNEWDLTRVVTTRAEVDMERIKE | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 13,206.824 | ||
Theoretical pI: | 5.984 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 26.172 | ||
aromaticity | 0.062 | ||
GRAVY | -0.695 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.124 | ||
sheet | 0.310 |