Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319708.1	internal	167	502-2(-)
Amino Acid sequence :
SMYQIVLFSHKAVESQVNIREKKAMELVKFVASKEGELVNIKGIAFVTILNILSNSTISNDLVDFEGKGIGEGMREWIRNYTKLEGVPQLADLFPILDGCTWDFQGTYKKLKDTFERISD VWRDIINKKRMEISNKYYEGEDFADALIRNGFEDKQINALLMELYSA
Physicochemical properties
Number of amino acids:		167
Molecular weight:		19,214.826
Theoretical pI:		5.177
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		25440 25440
Instability index:		27.597
aromaticity		0.108
GRAVY		-0.255
Secondary Structure Fraction
Helix		0.353
turn		0.198
sheet		0.263