Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319712.1 | internal | 162 | 487-2(-) |
Amino Acid sequence : | |||
KLEEDGNTVLPMEGLHEVGPPPFLSKTYEMVEDPSTDEVISWSKARNSFIVWDSHNFSTTLLPRFFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRRNVGQSMN QQGSSGPCIEIGYYGMEEELERLKRDKNLLMTEIVKLRQQQQ | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,886.146 | ||
Theoretical pI: | 7.105 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 49.273 | ||
aromaticity | 0.105 | ||
GRAVY | -0.747 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.259 | ||
sheet | 0.228 |