Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319716.1 | internal | 106 | 3-320(+) |
Amino Acid sequence : | |||
PTIAKNVESCLIKAFEPLGISDWNSIFWILHPGGNAIVDQVESALGLEPNKLRATRNILREYGNLSSACVLFILDEIRKKSGKEGLKTSGDGLDFGVFIIWAGLTI | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,572.240 | ||
Theoretical pI: | 5.793 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 36.352 | ||
aromaticity | 0.085 | ||
GRAVY | 0.160 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.274 | ||
sheet | 0.255 |