Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319729.1 | internal | 210 | 631-2(-) |
Amino Acid sequence : | |||
SLGRRDIVVAWRGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFQPLVHHGFYNIYTSDSSRSKFNKTSARDQVLAEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNGINKTS EGKEFPVSAFVFASPKVGDLNFQKAFSKLKHLHILRIHNLLDIVPKYPPVGYFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGID | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 23,437.421 | ||
Theoretical pI: | 6.492 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
Instability index: | 35.892 | ||
aromaticity | 0.100 | ||
GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.252 | ||
sheet | 0.214 |