Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319751.1	internal	158	475-2(-)
Amino Acid sequence :
GIPLFTANEALEFILENGRKIGRNSKNGFFRRVFRPSKVFNEVFGDLTLKDTMKGVLIPCYDLKTGAPFVFSRADAWEMDGCDFTLADVCGATMADRGIDLKSVDGRRKITAVGGGIAMT NPTAAAITHVLNNKQEFPFANGVEDLLVVSLGNGDSDS
Physicochemical properties
Number of amino acids:		158
Molecular weight:		17,067.263
Theoretical pI:		5.419
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		21.623
aromaticity		0.089
GRAVY		-0.056
Secondary Structure Fraction
Helix		0.297
turn		0.253
sheet		0.241