Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319758.1	internal	149	3-449(+)
Amino Acid sequence :
DFLLSPAGCPTSAFYAVVINEDFAQCKEGVKVITSTIPMKSPLFATSKNVNYLPNVLSKMEAEDKGAFASIWVDDSGYIAEGPNVNVAFITSDKELILPSFDKILSGCTAMRLLGLAPKL VEQGRLKSVKTADITVEDAKRAAEMMYVG
Physicochemical properties
Number of amino acids:		149
Molecular weight:		11,546.183
Theoretical pI:		9.461
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1740
Instability index:		49.863
aromaticity		0.078
GRAVY		-0.167
Secondary Structure Fraction
Helix		0.324
turn		0.245
sheet		0.127

Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319758.1	5prime_partial	102	449-141(-)
Amino Acid sequence :
SNIHHFSSSFGIFNCDISSFDTFQTSLLHQLRCQSKKPHSSAPTKDLIKARQNKLLIRSYKSNIHIRTLGDITTVVHPDRCKCSLILGLHFGEDIGKVVHIF*
Physicochemical properties
Number of amino acids:		102
Molecular weight:		11,546.183
Theoretical pI:		9.461
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1740
Instability index:		49.863
aromaticity		0.078
GRAVY		-0.167
Secondary Structure Fraction
Helix		0.324
turn		0.245
sheet		0.127