Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319760.1 | internal | 139 | 418-2(-) |
Amino Acid sequence : | |||
RVSNDTGPPSQPKNPINTFIYEMFNEDKRPGPISERSWGIFSTNGSNVYSISLGSSVGITDNSSAAFCIAKPGADENKLQDGINWACGQGRANCSAIQSGQPCYFPDTLQNHASYAYNDY YQRMRSVGGTCDFDGTCPG | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 11,514.394 | ||
Theoretical pI: | 10.860 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 51.603 | ||
aromaticity | 0.038 | ||
GRAVY | 0.221 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.238 | ||
sheet | 0.143 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319760.1 | 5prime_partial | 105 | 2-319(+) |
Amino Acid sequence : | |||
ARAGTIKITCSTNATHSLIIVIISIRSMILQSIRKITRLPRLNCTAISTSLTTSPVDSVLQFVLICTRFSYTKSCTRIVSNADRRTQTNGINIAPICRKDSPASF* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,514.394 | ||
Theoretical pI: | 10.860 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 51.603 | ||
aromaticity | 0.038 | ||
GRAVY | 0.221 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.238 | ||
sheet | 0.143 |