Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319765.1	internal	143	430-2(-)
Amino Acid sequence :
YREVVAKYSVEVRKLTMRMLDYICEGLGLKLGYFDNELSQIQMMLTNYYPPCPDPSSTLGSGGHYDGNLITLLQQDLPGLQQFIVKDATWIAVQPIPTAFVVNLGLTLKIISNEKFEGSI HRVVTDPTRDRVSIATLIGPDYS
Physicochemical properties
Number of amino acids:		143
Molecular weight:		15,998.270
Theoretical pI:		5.266
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17420 17545
Instability index:		24.606
aromaticity		0.091
GRAVY		-0.017
Secondary Structure Fraction
Helix		0.364
turn		0.238
sheet		0.224