Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319770.1 | internal | 182 | 547-2(-) |
Amino Acid sequence : | |||
EFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAA GFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKTLRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 19,856.521 | ||
Theoretical pI: | 4.654 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
Instability index: | 31.010 | ||
aromaticity | 0.121 | ||
GRAVY | 0.180 | ||
Secondary Structure Fraction | |||
Helix | 0.379 | ||
turn | 0.231 | ||
sheet | 0.231 |