Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319777.1 | 5prime_partial | 183 | 3-554(+) |
Amino Acid sequence : | |||
LGRRDSKTANFKKANVNIPAPNSTIQNLISLFHKQGLNEEDLVALSGGHTIGMARCVSFRQRLYNQNGDNLPDATLEKTYYSGLKSICPTSGGDNNISPLDVASPVRFDNSYFKLLLWGK GLLNSDEVLLTGNVKKTKELVKSYAENEALFLHQFAKSMVKMGKINPLTELKGEIRKNCRRVN* | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,344.077 | ||
Theoretical pI: | 9.539 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 36.535 | ||
aromaticity | 0.071 | ||
GRAVY | -0.448 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.290 | ||
sheet | 0.246 |