Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319778.1	internal	159	477-1(-)
Amino Acid sequence :
SMKSIFERYNEEKEHYQLLTPSSEAKFWRTEAERLRQQLDDLQENYRRLKGEELSGMRISDLHNLENELETRLKNIRIKKEKMLTDEIEELNRKSSLIGHENIELSKKVTLIYQENRELH KKVYGATDDGKEEGSCSGQTSAKESCVPLHLQQPNINTT
Physicochemical properties
Number of amino acids:		159
Molecular weight:		18,678.718
Theoretical pI:		5.814
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		59.940
aromaticity		0.050
GRAVY		-1.100
Secondary Structure Fraction
Helix		0.245
turn		0.208
sheet		0.314