Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319781.1 | internal | 154 | 464-3(-) |
Amino Acid sequence : | |||
HDCMVKSCDASVYLDTANGQESEKTSPRNFGMRNFKYIETIKQALENECPNTVSCADIVALSARDGLLWLGGPRVEMRTGRKDSKESYLAEVENYLPNHNDSMSSVLSRFQSIGVDTEGT VALLGAHSVGRVHCVNLVHRLYPTVDPTIDPDYA | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 17,008.885 | ||
Theoretical pI: | 5.294 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
Instability index: | 39.331 | ||
aromaticity | 0.065 | ||
GRAVY | -0.387 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.260 | ||
sheet | 0.240 |