Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319783.1 | internal | 144 | 434-3(-) |
Amino Acid sequence : | |||
PNMQTMRLISRAAFEVDDYWRIVDILHKRLSRFDTRNWRPSYKALMLLEYLLTHGPESMAEEFQSDEDVITQMGSFQHVDEKGFNWGLSVRKMSERVIKLLEDRSLLKEERERARKVTVG IKGFGSFCERPISGQETMKEAISE | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,931.189 | ||
Theoretical pI: | 6.423 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 33.257 | ||
aromaticity | 0.090 | ||
GRAVY | -0.587 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.188 | ||
sheet | 0.292 |