Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319783.1	internal	144	434-3(-)
Amino Acid sequence :
PNMQTMRLISRAAFEVDDYWRIVDILHKRLSRFDTRNWRPSYKALMLLEYLLTHGPESMAEEFQSDEDVITQMGSFQHVDEKGFNWGLSVRKMSERVIKLLEDRSLLKEERERARKVTVG IKGFGSFCERPISGQETMKEAISE
Physicochemical properties
Number of amino acids:		144
Molecular weight:		16,931.189
Theoretical pI:		6.423
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 20970
Instability index:		33.257
aromaticity		0.090
GRAVY		-0.587
Secondary Structure Fraction
Helix		0.292
turn		0.188
sheet		0.292