Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319787.1	internal	174	523-2(-)
Amino Acid sequence :
EAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVT LIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKTLRPGGVV
Physicochemical properties
Number of amino acids:		174
Molecular weight:		18,968.544
Theoretical pI:		4.712
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11920 11920
Instability index:		31.048
aromaticity		0.115
GRAVY		0.181
Secondary Structure Fraction
Helix		0.379
turn		0.224
sheet		0.224