Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319811.1 | internal | 190 | 570-1(-) |
Amino Acid sequence : | |||
GSVVAEAIRKERRMGASLIRLFFHDCFVDGCDAGILLNDIPGRFQGEKSSPPNDNSVRGYEVIDEAKQRIKTMCPAASVSCADILALAARDSVAMLGGIPYPVRLGRSDARTANFTGALT QLPAPFDDLNVQLTKFRVKGMSAREMVALAGAHTVGFARCVTMCDDRNINPARKSTLNCGCPVNNNNTNL | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 20,433.235 | ||
Theoretical pI: | 8.691 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3480 | ||
Instability index: | 32.788 | ||
aromaticity | 0.053 | ||
GRAVY | -0.114 | ||
Secondary Structure Fraction | |||
Helix | 0.253 | ||
turn | 0.258 | ||
sheet | 0.258 |