Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319818.1 | internal | 122 | 366-1(-) |
Amino Acid sequence : | |||
SAIIGILASIRRPELFSKLILIGASPRFLNDEDCHGGFEQGEIEKVFSAMEANYAAWVNGFAPLAVGADVPAAVREFSRTLFNMRPDITLFVSRTVFNSDMRGVLGLVKVPCHIFQTARD HS | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,411.291 | ||
Theoretical pI: | 6.259 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 42.677 | ||
aromaticity | 0.098 | ||
GRAVY | 0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.238 | ||
sheet | 0.270 |