Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319829.1 | internal | 183 | 550-2(-) |
Amino Acid sequence : | |||
VGEPKKEYILGFIMTLVTAALTGLIFPLVELIYKKAQQAITYTLVLEFQTVYCFVATVLSTIGMIINNDFQAISREAKAFELGESRYYVVIVWSVIILQFYFLGTIGVIYSASSLVSGIL ISVLLPVTEVLAVFLYGENFSAEKGVSLALSLWGFASYFYGDYKENKKRENNQSPETKMIDKI | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,492.736 | ||
Theoretical pI: | 5.242 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 28880 | ||
Instability index: | 30.676 | ||
aromaticity | 0.142 | ||
GRAVY | 0.545 | ||
Secondary Structure Fraction | |||
Helix | 0.454 | ||
turn | 0.197 | ||
sheet | 0.273 |