Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319830.1	3prime_partial	127	381-1(-)
Amino Acid sequence :
MGMTSPPAPVTENVFSGVPVVVGGGDYGNRIYSDDERSDQSVGVGYRNPAPIQQLQQQQLQPKPVVIPSDLPSPNSVSSESSVTNPLSGQRHFFYQEQGGQIQSGNNRASPNSVDMKHHI DPNSRVQ
Physicochemical properties
Number of amino acids:		127
Molecular weight:		13,700.835
Theoretical pI:		5.425
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 5960
Instability index:		73.125
aromaticity		0.055
GRAVY		-0.752
Secondary Structure Fraction
Helix		0.236
turn		0.409
sheet		0.110