Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319831.1	internal	140	1-420(+)
Amino Acid sequence :
IRYGHMIDNVVLIVTGTLHERDVQELLEKCHPLGMFDSIASLAVAQNMRELYRLVLVDTPLAPYFSECITSEDLDDMNIEIMRNTLYKAYLEDFYRFCQKLGGATAEIMSDLLSFEADRR AVNITINSIGTELTRDDRRK
Physicochemical properties
Number of amino acids:		140
Molecular weight:		16,096.276
Theoretical pI:		4.808
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8940 9065
Instability index:		40.260
aromaticity		0.079
GRAVY		-0.120
Secondary Structure Fraction
Helix		0.336
turn		0.157
sheet		0.307