Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319845.1 | 5prime_partial | 144 | 451-17(-) |
Amino Acid sequence : | |||
EDLVALSGGHTIGMARCVSFRQRLYNQNGDNLPDATLEKTYYSGLKSICPTSGGDNNISPLDVASPVRFDNSYFKLLLWGKGLLNSDEVLLTGNVKKAKELVKSYAENEALFLHQFAKSM VKMGKINPLTELKGEIRKNCRRVN* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,996.188 | ||
Theoretical pI: | 9.157 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 29.417 | ||
aromaticity | 0.076 | ||
GRAVY | -0.366 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.278 | ||
sheet | 0.264 |